PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G073400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 318aa    MW: 34818.7 Da    PI: 8.3093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G073400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-161462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
  Sevir.9G073400.1.p 14 KGPWSPEEDAKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding40.18.6e-1369111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +++eEd++++ +    G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.9G073400.1.p  69 GGFSEEEDKIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.706962IPR017930Myb domain
SuperFamilySSF466892.7E-2611109IPR009057Homeodomain-like
SMARTSM007176.5E-121364IPR001005SANT/Myb domain
PfamPF002494.9E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-241569IPR009057Homeodomain-like
CDDcd001673.71E-91662No hitNo description
PROSITE profilePS5129421.79163117IPR017930Myb domain
SMARTSM007176.2E-1267115IPR001005SANT/Myb domain
PfamPF002491.4E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2370117IPR009057Homeodomain-like
CDDcd001672.54E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDKIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
QSRKDQRQQQ QFMRQATASD GMKQEAATGD ANGSSGVPAV AYNWHQQAIT GAVPPVPGIM  180
MEGHRIGDEV DESIRKLLYK LGGAGPFATL PVTQCVPPMY EGSPSLMPPS CTVDTTSLSE  240
GGVQGSSTLP ALELDQNFHF NQVKLDGLDC FFGMSTDQSM RWNEVIPLVC PNNTVASSSQ  300
GMQQYCLVDE PANLGMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1120181e-145AK112018.1 Oryza sativa Japonica Group cDNA clone:006-308-C02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981607.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLK4ACS40.0K4ACS4_SETIT; Uncharacterized protein
STRINGSi036681m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-80myb domain protein 36